PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr009003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 795aa    MW: 86911.7 Da    PI: 6.6352
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr009003.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS325.21.3e-994337933374
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  ++L+++Ae v +g+++ aq +Larl+++ sp g+p+qR+a+yf+eAL+  +++  + ++   pp++ ++ ++  ++ a+k+fsevsP+l+f ++t+Nq
  Pbr009003.1 433 DQLYKAAELVGTGNFSHAQGILARLNHQLSPVGKPLQRAAFYFKEALQLLMNN--PATF--PPPRTRTPFDVFFKMGAYKVFSEVSPLLQFVNFTCNQ 526
                  79**************************************************9..4444..5888888889*************************** PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl..eleeL 194
                  a+lea++ ++++Hi+Dfdi+ G++W++++q+L +R+   ++pslRiT+++sp++++  el  ++++L++fA+e+g++fe +v+  + l++   +l  +
  Pbr009003.1 527 ALLEALSDADQIHIVDFDIGFGAHWASFMQELPTRNrgVSAPSLRITAFASPSTHHPVELGLMRDNLTEFANEIGISFELDVVNLDYLDQNsySLPII 624
                  ************************************66679*****************************************9777555541255667 PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  +++ gEa+aVn+ +   ++ +++++l++    vL++vk lsPk+vv  ++ +d+++ +F +++l+al+ y  l++sl+a    +s++ +k+Er+ll++
  Pbr009003.1 625 QTNDGEAVAVNFPI--WSTSNQPAALPN----VLRFVKLLSPKIVVSLDRGCDRSDLPFPQHILQALQSYINLLESLDAI-NVTSDAVSKIERFLLQP 715
                  8888********99..666678999999....*********************************************887.689************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +i++ v  + +       ++  W+  + +aGF+pvp+s+++++qa++++++ + +g++ve++++sl+l+W++r+L+s+SaWr
  Pbr009003.1 716 KIESTVLGRLRT----PDKMPIWKTLFASAGFTPVPFSNFTETQAECVVKRNPARGFHVEKRQESLILCWQRRELISASAWR 793
                  ******998887....999**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.903405773IPR005202Transcription factor GRAS
PfamPF035144.4E-97433793IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 795 aa     Download sequence    Send to blast
MPFQFQQGKA VVEITTASLP AIFTDSSCSK YKDGGFFNHH HHSFPTGEPN SVLHMRRSPS  60
PPTSASTLSS SFNKGGGGGD KSTSLAAETL PAVGPASSKD EWACELQSIR SGGLEAVTGS  120
GGGVERCGLG LGGLEDWETM LSETAASPAH DQSLLRWIAG DVDDMSCGLK QLLQSGNGNH  180
HNSPIDFDGN AGLGIVDQGP NFDLIGSSGV SVPNFGFAGS GFSNGGNNGS NGKVGFVPHR  240
SGSFGLLNYK VSNVGLMYNN GGTNSVNCNI QNPIFSNSSN TVALPVSLPA VYGQQQFESS  300
PDEKPQILNP QLFMSNQTQQ PQNPSFFMPL AYAQQEQYHL LQSQPKRHNS GSNVNLSTHQ  360
IQKGQFSDPR HDIFVRHQQQ QQLGFAQGMQ FLPQQHHIQQ KPLMVPKQTV VLGNGEEMTH  420
HQQQQQLQDT VLDQLYKAAE LVGTGNFSHA QGILARLNHQ LSPVGKPLQR AAFYFKEALQ  480
LLMNNPATFP PPRTRTPFDV FFKMGAYKVF SEVSPLLQFV NFTCNQALLE ALSDADQIHI  540
VDFDIGFGAH WASFMQELPT RNRGVSAPSL RITAFASPST HHPVELGLMR DNLTEFANEI  600
GISFELDVVN LDYLDQNSYS LPIIQTNDGE AVAVNFPIWS TSNQPAALPN VLRFVKLLSP  660
KIVVSLDRGC DRSDLPFPQH ILQALQSYIN LLESLDAINV TSDAVSKIER FLLQPKIEST  720
VLGRLRTPDK MPIWKTLFAS AGFTPVPFSN FTETQAECVV KRNPARGFHV EKRQESLILC  780
WQRRELISAS AWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3245079322375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009351036.10.0PREDICTED: scarecrow-like protein 22
TrEMBLM5WE330.0M5WE33_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s11020.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132692130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-119GRAS family protein